Structure of PDB 4ofh Chain A

Receptor sequence
>4ofhA (length=141) Species: 9606 (Homo sapiens) [Search protein sequence]
WTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPS
AEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGI
GKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLS
3D structure
PDB4ofh Structure of MBD4 bound to O6MeG:T mispair DNA
ChainA
Resolution2.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.2.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A L447 V448 Q449 L466 N467 R468 S470 G536 I537 G538 Y540 G541 N560 K562 L10 V11 Q12 L29 N30 R31 S33 G99 I100 G101 Y103 G104 N123 K125
BS02 dna A R468 P505 L506 G507 L508 Y509 D510 L511 R31 P68 L69 G70 L71 Y72 D73 L74
BS03 MG A I532 L534 I537 I95 L97 I100
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ofh, PDBe:4ofh, PDBj:4ofh
PDBsum4ofh
PubMed
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]