Structure of PDB 4odp Chain A

Receptor sequence

>4odpA (length=101) Species: 9606,300852

MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHH
H

3D structure

• PDB: 4odp Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
• Chain: A
• Resolution: 1.747 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y13 L22 D23 I37 F80
• Catalytic site (residue number reindexed from 1): Y13 L22 D23 I37 F71
• Enzyme Commision number: 5.2.1.8: peptidylprolyl isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	R34 N35 L36 I37	R34 N35 L36 I37
BS02	CA	A	H33 R34 N35	H33 R34 N35

Gene Ontology

Molecular Function

• GO:0003755 peptidyl-prolyl cis-trans isomerase activity

External links

• PDB: RCSB:4odp, PDBe:4odp, PDBj:4odp
• PDBsum: 4odp
• PubMed: 27664121
• UniProt: P62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A (Gene Name=FKBP1A);
  Q5SLE7