Structure of PDB 4oci Chain A |
>4ociA (length=139) Species: 885318 (Entamoeba histolytica HM-1:IMSS-A) [Search protein sequence] |
LKESFLLFDGDGDGYLTLNEFESLVRVLGVVMETSAIASTYNSNSKVRGM SYELFTSCFSQLKTKSFNKDEIKTAINVLDKDKKGFIPAIELRRILSTIG DNMEQKEITDLFTFMGIDEQGVVKVDDFINQDNHHHHHH |
|
PDB | 4oci Crystal Structure of Calcium Binding Protein-5 from Entamoeba histolytica and Its Involvement in Initiation of Phagocytosis of Human Erythrocytes. |
Chain | A |
Resolution | 2.009 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D16 D18 D20 Y22 |
D9 D11 D13 Y15 |
|
|
|
|