Structure of PDB 4oc6 Chain A |
>4oc6A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] |
GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLD IACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQS |
|
PDB | 4oc6 Structure-based optimization of non-peptidic Cathepsin D inhibitors. |
Chain | A |
Resolution | 2.64 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2S1 |
A |
D33 G35 Y78 G79 S80 |
D33 G35 Y78 G79 S80 |
PDBbind-CN: -logKd/Ki=7.07,IC50=85nM BindingDB: IC50=85nM,Ki=0.700000nM |
|
|
|