Structure of PDB 4obz Chain A |
>4obzA (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] |
PIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDI ACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQS |
|
PDB | 4obz Structure-based optimization of non-peptidic Cathepsin D inhibitors. |
Chain | A |
Resolution | 2.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2S4 |
A |
D33 Y78 |
D32 Y77 |
PDBbind-CN: -logKd/Ki=5.72,IC50=1.9uM BindingDB: IC50=1900nM |
|
|
|