Structure of PDB 4o79 Chain A

Receptor sequence

>4o79A (length=210) Species: 3702 (Arabidopsis thaliana)

PIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGL
ILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDK
GIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVF
LGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILIL
GGFVILGVVT

3D structure

• PDB: 4o79 Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
• Chain: A
• Resolution: 2.003 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.3: ascorbate ferrireductase (transmembrane).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	W29 F48 H51 M55 L103 H106 N113 S116 H118 S119 G122 A168 T171 A172 G175 I176 E178	W20 F39 H42 M46 L94 H97 N104 S107 H109 S110 G113 A159 T162 A163 G166 I167 E169
BS02	HEM	A	M67 Y70 H84 L85 Q88 F129 Q132 W133 G136 F137 Y140 M154 H157 V158 G161	M58 Y61 H75 L76 Q79 F120 Q123 W124 G127 F128 Y131 M145 H148 V149 G152

Gene Ontology

Molecular Function

• GO:0000293 ferric-chelate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0140571 transmembrane ascorbate ferrireductase activity

Biological Process

• GO:0019852 L-ascorbic acid metabolic process
• GO:0055085 transmembrane transport

Cellular Component

• GO:0005794 Golgi apparatus
• GO:0016020 membrane

External links

• PDB: RCSB:4o79, PDBe:4o79, PDBj:4o79
• PDBsum: 4o79
• PubMed: 24449903
• UniProt: Q9SWS1|ACFR2_ARATH Transmembrane ascorbate ferrireductase 2 (Gene Name=CYB561B)