Structure of PDB 4o3o Chain A

Receptor sequence

>4o3oA (length=431) Species: 9606 (Homo sapiens)

GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGI
IAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASV
EVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYI
EGLPQGPTTVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMR
AAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMP
IRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAM
CRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEER
LTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFT
VIKNCNTSGIQTEWSPPLTMLFLCATKFSAS

3D structure

• PDB: 4o3o Kinetics, Structure, and Mechanism of 8-Oxo-7,8-dihydro-2'-deoxyguanosine Bypass by Human DNA Polymerase eta
• Chain: A
• Resolution: 1.698 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 S62 K86 K311 P316 K317 T318 G320 C321 S322 K323 N324 P326 R351	Q41 Y42 W45 S65 K89 K310 P315 K316 T317 G319 C320 S321 K322 N323 P325 R350
BS02	dna	A	S113 E116 S257 G259 G260 K261 L262 L381 R382 R383 C384	S116 E119 S256 G258 G259 K260 L261 L380 R381 R382 C383
BS03	DZ4	A	D13 M14 D15 C16 F17 F18 Y52 R55 R61 D115 K231	D16 M17 D18 C19 F20 F21 Y55 R58 R64 D118 K230
BS04	MG	A	D13 M14 D115	D16 M17 D118
BS05	MG	A	D13 D115 E116	D16 D118 E119

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4o3o, PDBe:4o3o, PDBj:4o3o
• PDBsum: 4o3o
• PubMed: 24759104
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)