Structure of PDB 4o2g Chain A

Receptor sequence
>4o2gA (length=146) Species: 10090 (Mus musculus) [Search protein sequence]
RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSP
EDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVR
LSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAWVQAMSRGW
3D structure
PDB4o2g Engineering the internal cavity of neuroglobin demonstrates the role of the haem-sliding mechanism.
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.7.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A L41 F42 Y44 H64 K67 L92 H96 V101 S105 F106 V109 Y137 M144 L39 F40 Y42 H62 K65 L90 H94 V99 S103 F104 V107 Y135 M142
Gene Ontology
Molecular Function
GO:0005092 GDP-dissociation inhibitor activity
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0098809 nitrite reductase activity
Biological Process
GO:0015671 oxygen transport
GO:0071456 cellular response to hypoxia
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4o2g, PDBe:4o2g, PDBj:4o2g
PDBsum4o2g
PubMed24914975
UniProtQ9ER97|NGB_MOUSE Neuroglobin (Gene Name=Ngb)

[Back to BioLiP]