Structure of PDB 4o0a Chain A

Receptor sequence

>4o0aA (length=123) Species: 9606 (Homo sapiens)

GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMS
DGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILM
ELEVLKSAEAVGVKIGNPVPYNE

3D structure

• PDB: 4o0a Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
• Chain: A
• Resolution: 1.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2P9	A	R31 I33 T34 R41 R43 S55 M57 A59 T60 N85 V93 I95	R34 I36 T37 R44 R46 S58 M60 A62 T63 N88 V96 I98	PDBbind-CN: -logKd/Ki=6.72,Kd=0.19uM BindingDB: Kd=190nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006260 DNA replication

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4o0a, PDBe:4o0a, PDBj:4o0a
• PDBsum: 4o0a
• PubMed: 24147804
• UniProt: P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)