Structure of PDB 4nxc Chain A

Receptor sequence
>4nxcA (length=153) Species: 9755 (Physeter catodon) [Search protein sequence]
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK
TEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIP
IKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG
YQG
3D structure
PDB4nxc Crystallographic Studies with Xenon and Nitrous Oxide Provide Evidence for Protein-dependent Processes in the Mechanisms of General Anesthesia
ChainA
Resolution1.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.11.1.-
1.7.-.-
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM A F43 R45 H64 V68 L89 S92 H93 H97 I99 Y103 F43 R45 H64 V68 L89 S92 H93 H97 I99 Y103
BS02 ZN A H36 E38 H36 E38
BS03 ZN A E59 K62 E59 K62
BS04 N2O A L89 H93 I142 L89 H93 I142
BS05 N2O A L104 S108 F138 L104 S108 F138
BS06 N2O A L76 A134 F138 L76 A134 F138
BS07 N2O A I28 L29 G65 V68 L69 I28 L29 G65 V68 L69
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0098809 nitrite reductase activity
Biological Process
GO:0015671 oxygen transport
GO:0019430 removal of superoxide radicals
Cellular Component
GO:0005737 cytoplasm
GO:0016528 sarcoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4nxc, PDBe:4nxc, PDBj:4nxc
PDBsum4nxc
PubMed25211169
UniProtP02185|MYG_PHYMC Myoglobin (Gene Name=MB)

[Back to BioLiP]