Structure of PDB 4ntm Chain A

Receptor sequence
>4ntmA (length=114) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MMSTTLFKDFTFEAAHRLPHCGRLHGHSFMVRLEITGEVDPHTGWIIDFA
ELKAAFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAV
MVKETCTAGCIYRG
3D structure
PDB4ntm Biochemical and Structural Studies of 6-Carboxy-5,6,7,8-tetrahydropterin Synthase Reveal the Molecular Basis of Catalytic Promiscuity within the Tunnel-fold Superfamily.
ChainA
Resolution2.05 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C27 H31 H33 E110
Catalytic site (residue number reindexed from 1) C21 H25 H27 E104
Enzyme Commision number 4.1.2.50: 6-carboxytetrahydropterin synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H16 H31 H33 H16 H25 H27
BS02 2K8 A H16 T84 S85 E86 E110 H16 T78 S79 E80 E104
BS03 2K8 A W51 I53 D54 F55 W45 I47 D48 F49
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0016829 lyase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0070497 6-carboxy-5,6,7,8-tetrahydropterin synthase activity
Biological Process
GO:0008616 queuosine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ntm, PDBe:4ntm, PDBj:4ntm
PDBsum4ntm
PubMed24990950
UniProtP65870|QUED_ECOLI 6-carboxy-5,6,7,8-tetrahydropterin synthase (Gene Name=queD)

[Back to BioLiP]