Structure of PDB 4nt5 Chain A |
>4nt5A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] |
EPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQ CSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK |
|
PDB | 4nt5 Highly reinforced structure of a C-terminal dimerization domain in von Willebrand factor. |
Chain | A |
Resolution | 3.281 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D2746 H2748 |
D26 H28 |
|
|
|