Structure of PDB 4nrc Chain A |
>4nrcA (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVI KKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGH NMRKYFEKKWTDTFK |
|
PDB | 4nrc Targeting low-druggability bromodomains: fragment based screening and inhibitor design against the BAZ2B bromodomain. |
Chain | A |
Resolution | 1.86 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2LY |
A |
P1888 F1889 |
P33 F34 |
MOAD: ic50=241uM PDBbind-CN: -logKd/Ki=3.62,IC50=241uM BindingDB: IC50=241000nM |
|
|