Structure of PDB 4nra Chain A |
>4nraA (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVI KKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGH NMRKYFEKKWTDTFKV |
|
PDB | 4nra Targeting low-druggability bromodomains: fragment based screening and inhibitor design against the BAZ2B bromodomain. |
Chain | A |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2LW |
A |
P1888 N1944 I1950 |
P33 N89 I95 |
MOAD: Kd=65uM PDBbind-CN: -logKd/Ki=4.19,Kd=65uM BindingDB: IC50=37000nM,Kd=65000nM |
|
|