Structure of PDB 4npt Chain A

Receptor sequence

>4nptA (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPIVTIKVGGQLREALINTGADDTIFEEISLPGRWKPKLIGGI
GGFMKVRQYDQIPIEIAGHKAIGTVLVGPTPINVIGRNMLTQIGATLNF

3D structure

• PDB: 4npt Structures of darunavir-resistant HIV-1 protease mutant reveal atypical binding of darunavir to wide open flaps.
• Chain: A
• Resolution: 1.66 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N25 T26 G27
• Catalytic site (residue number reindexed from 1): N25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	017	A	N25 I47 G48 I50 G52 M54 V84	N25 I47 G48 I50 G52 M54 V84

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:4npt, PDBe:4npt, PDBj:4npt
• PDBsum: 4npt
• PubMed: 24738918
• UniProt: O38896