Structure of PDB 4nlg Chain A

Receptor sequence

>4nlgA (length=344) Species: 2285 (Sulfolobus acidocaldarius)

MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEA
RKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIE
VASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKI
LAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGI
QKLRDILSKNYNELEKITGKAKALYLLKLAQNKYSEPVENKSRKSHGRYL
TLPYNTRDVKVILPYLKKAINEAYNKVNGIPMRITVIAIMEDLDILSKGK
KFKHGISIDNAYKVAEDLLRELLVRDKRRNVRRIGVKLDNIIIN

3D structure

• PDB: 4nlg Three Residues of the Interdomain Linker Determine the Conformation and Single-base Deletion Fidelity of Y-family Translesion Polymerases.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	E106 K153 S297 K298 G299 K300 K301 K303	E106 K153 S297 K298 G299 K300 K301 K303
BS02	dna	A	V32 S34 G41 A42 P60 I62 K63 Q66 K78 A221 R243 K244 S245 H246 G247 R248 Y249 T251 K276 L293 R332 R333	V32 S34 G41 A42 P60 I62 K63 Q66 K78 A221 R243 K244 S245 H246 G247 R248 Y249 T251 K276 L293 R332 R333
BS03	CA	A	D7 D105 E106	D7 D105 E106
BS04	CA	A	D7 F8 D105	D7 F8 D105
BS05	DCP	A	Y10 F11 F12 T45 R51 D105 K160	Y10 F11 F12 T45 R51 D105 K160

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4nlg, PDBe:4nlg, PDBj:4nlg
• PDBsum: 4nlg
• PubMed: 24415763
• UniProt: Q4JB80|DPO4_SULAC DNA polymerase IV (Gene Name=dbh)