Structure of PDB 4njs Chain A

Receptor sequence

>4njsA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]

PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMELPGRWKPRMIGGI
GGFVKVRQYDQIPIEICGHKVIGTVLVGPTPTNIIGRNLMTQLGCTLNF

3D structure

PDB

4njs A Conserved Hydrogen-Bonding Network of P2 bis-Tetrahydrofuran-Containing HIV-1 Protease Inhibitors (PIs) with a Protease Active-Site Amino Acid Backbone Aids in Their Activity against PI-Resistant HIV.

Chain

Resolution

1.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D25 T26 G27
Catalytic site (residue number reindexed from 1)	D25 T26 G27
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	G08	A	D25 A28 D30 T82	D25 A28 D30 T82

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4njs, PDBe:4njs, PDBj:4njs
PDBsum	4njs
PubMed	24752271
UniProt	Q9J006

[Back to BioLiP]