Structure of PDB 4nih Chain A

Receptor sequence

>4nihA (length=201) Species: 562 (Escherichia coli)

PLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTN
CGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQ
PDACLINRYAPGAKLCLHQDKDLPDLRAPIVSVSLGLPAIFQFGGLKRND
PLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
K

3D structure

• PDB: 4nih Switching Demethylation Activities between AlkB Family RNA/DNA Demethylases through Exchange of Active-Site Residues.
• Chain: A
• Resolution: 1.374 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.33: DNA oxidative demethylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	T51 P52 G53 Y55 M57 W69 G75 Y76 K127 C129 H131	T38 P39 G40 Y42 M44 W56 G62 Y63 K114 C116 H118
BS02	dna	A	R161 N162 R167	R148 N149 R154
BS03	MN	A	H131 D133 H187	H118 D120 H174
BS04	AKG	A	N120 Y122 L128 H131 H187 I189 R204 N206	N107 Y109 L115 H118 H174 I176 R191 N193

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0035515 oxidative RNA demethylase activity
• GO:0035516 broad specificity oxidative DNA demethylase activity
• GO:0046872 metal ion binding
• GO:0051213 dioxygenase activity

Biological Process

• GO:0006281 DNA repair
• GO:0006307 DNA alkylation repair
• GO:0035513 oxidative RNA demethylation
• GO:0042245 RNA repair
• GO:0070989 oxidative demethylation
• GO:0072702 response to methyl methanesulfonate

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4nih, PDBe:4nih, PDBj:4nih
• PDBsum: 4nih
• PubMed: 24596302
• UniProt: P05050|ALKB_ECOLI Alpha-ketoglutarate-dependent dioxygenase AlkB (Gene Name=alkB)