Structure of PDB 4ni9 Chain A

Receptor sequence
>4ni9A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRQPLTSSERIDKQIRYILDGISALRKETNLNLPKMAEKDGCFQSGFNE
ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA
PTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
3D structure
PDB4ni9 Crystal structure of interleukin-6 in complex with a modified nucleic Acid ligand.
ChainA
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R16 R24 K27 Q28 R30 Y31 L33 D34 A114 M117 S118 V121 F125 Q175 L178 R3 R11 K14 Q15 R17 Y18 L20 D21 A84 M87 S88 V91 F95 Q135 L138
BS02 dna A S107 S108 E109 E110 Q111 S77 S78 E79 E80 Q81
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005138 interleukin-6 receptor binding
Biological Process
GO:0006955 immune response
GO:0030154 cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ni9, PDBe:4ni9, PDBj:4ni9
PDBsum4ni9
PubMed24415767
UniProtP05231|IL6_HUMAN Interleukin-6 (Gene Name=IL6)

[Back to BioLiP]