Structure of PDB 4ndq Chain A

Receptor sequence

>4ndqA (length=245) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

KRPIRLLPWLQVVKIGGRVMDRGADAILPLVEELRKLLPEHRLLILTGAG
VRARHVFSVGLDLGLPVGSLAPLAASEAGQNGHILAAMLASEGVSYVEHP
TVADQLAIHLSATRAVVGSAFPPYHHHEFPGSRIPPHRADTGAFLLADAF
GAAGLTIVENVDGIYTADPNGPDRGQARFLPETSATDLAKSEGPLPVDRA
LLDVMATARHIERVQVVNGLVPGRLTAALRGEHVGTLIRTGVRPA

3D structure

PDB

4ndq Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.

Chain

Resolution

1.751 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	8M0	A	H156 H157 H158	H125 H126 H127
BS02	ATP	A	K45 G47 G48 R49 A80 E190 N191 Y196 D199 P200 N201 P225 L226 P227	K14 G16 G17 R18 A49 E159 N160 Y165 D168 P169 N170 P194 L195 P196
BS03	MG	A	D171 P227	D140 P196
BS04	8M0	A	A106 S107 G110 H114 Y127 E129 H130 P131 S150 P154 H156	A75 S76 G79 H83 Y96 E98 H99 P100 S119 P123 H125

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4ndq, PDBe:4ndq, PDBj:4ndq
PDBsum	4ndq
PubMed	24945101
UniProt	P84308\|MOSA_AZOVD Molybdenum storage protein subunit alpha (Gene Name=mosA)

[Back to BioLiP]