Structure of PDB 4ndp Chain A

Receptor sequence

>4ndpA (length=245) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

KRPIRLLPWLQVVKIGGRVMDRGADAILPLVEELRKLLPEHRLLILTGAG
VRARHVFSVGLDLGLPVGSLAPLAASEAGQNGHILAAMLASEGVSYVEHP
TVADQLAIHLSATRAVVGSAFPPYHHHEFPGSRIPPHRADTGAFLLADAF
GAAGLTIVENVDGIYTADPNGPDRGQARFLPETSATDLAKSEGPLPVDRA
LLDVMATARHIERVQVVNGLVPGRLTAALRGEHVGTLIRTGVRPA

3D structure

PDB

4ndp Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.

Chain

Resolution

1.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	8M0	A	H156 H157 H158	H125 H126 H127
BS02	ATP	A	K45 G47 G48 R49 A80 E190 N191 V192 Y196 D199 P200 N201 P225 L226 P227	K14 G16 G17 R18 A49 E159 N160 V161 Y165 D168 P169 N170 P194 L195 P196
BS03	8M0	A	P103 A106 S107 G110 Q111 H114 Y127 E129 H130 P131 S150 P154 H156	P72 A75 S76 G79 Q80 H83 Y96 E98 H99 P100 S119 P123 H125
BS04	MG	A	E190 P227	E159 P196

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4ndp, PDBe:4ndp, PDBj:4ndp
PDBsum	4ndp
PubMed	24945101
UniProt	P84308\|MOSA_AZOVD Molybdenum storage protein subunit alpha (Gene Name=mosA)

[Back to BioLiP]