Structure of PDB 4nbu Chain A

Receptor sequence
>4nbuA (length=242) Species: 161544 (Bacillus sp. SG-1) [Search protein sequence]
SRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEANP
GVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVD
QFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNY
AAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMK
AQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM
3D structure
PDB4nbu Biochemical and Structural Studies of NADH-Dependent FabG Used To Increase the Bacterial Production of Fatty Acids under Anaerobic Conditions.
ChainA
Resolution1.34 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAI A G20 N23 G24 I25 D44 F45 V65 D66 V67 N93 G95 I96 T143 S145 Y158 K162 P188 F190 T191 T193 M195 G12 N15 G16 I17 D36 F37 V57 D58 V59 N85 G87 I88 T135 S137 Y150 K154 P180 F182 T183 T185 M187
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Dec 12 18:40:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4nbu', asym_id = 'A', title = 'Biochemical and Structural Studies of NADH-Depen...ction of Fatty Acids under Anaerobic Conditions. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4nbu', asym_id='A', title='Biochemical and Structural Studies of NADH-Depen...ction of Fatty Acids under Anaerobic Conditions. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '4nbu', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='4nbu', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>