Structure of PDB 4nay Chain A |
>4nayA (length=129) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] |
HHLKSINHICFSVRNLNDSIHFYRDILLGKLLLTGKKTAYFELAGLWIAL NEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILQSIYFTDP DGHKLELHTGTLENRLNYYKEAKPHMTFY |
|
PDB | 4nay Structure and Function of the Genomically Encoded Fosfomycin Resistance Enzyme, FosB, from Staphylococcus aureus. |
Chain | A |
Resolution | 1.42 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H66 E115 |
H67 E106 |
|
|
|
|