Structure of PDB 4my2 Chain A

Receptor sequence
>4my2A (length=474) Species: 9606,83333 [Search protein sequence]
IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVA
ATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNG
KLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNL
QEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKN
KHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFK
GQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGA
VALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAA
SGRQTVDEALKDAQTNAAAEFIMDSDPRRCMRHHYVDSISHPLYKCSSKM
VLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLR
CSGGMRLTATYRYILSCHCEECNS
3D structure
PDB4my2 Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A D16 K17 E113 Y157 W232 D13 K14 E110 Y154 W229
BS02 GLC A W64 D67 R68 E155 P156 Y157 W342 W61 D64 R65 E152 P153 Y154 W339
Gene Ontology
Molecular Function
GO:0005109 frizzled binding
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0000320 re-entry into mitotic cell cycle
GO:0001508 action potential
GO:0001525 angiogenesis
GO:0001666 response to hypoxia
GO:0001890 placenta development
GO:0001974 blood vessel remodeling
GO:0002088 lens development in camera-type eye
GO:0003406 retinal pigment epithelium development
GO:0003407 neural retina development
GO:0006099 tricarboxylic acid cycle
GO:0006366 transcription by RNA polymerase II
GO:0006544 glycine metabolic process
GO:0006622 protein targeting to lysosome
GO:0006749 glutathione metabolic process
GO:0006954 inflammatory response
GO:0007033 vacuole organization
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0007224 smoothened signaling pathway
GO:0007399 nervous system development
GO:0007601 visual perception
GO:0008104 protein localization
GO:0008283 cell population proliferation
GO:0008643 carbohydrate transport
GO:0009069 serine family amino acid metabolic process
GO:0010467 gene expression
GO:0010842 retina layer formation
GO:0014004 microglia differentiation
GO:0016055 Wnt signaling pathway
GO:0016358 dendrite development
GO:0016567 protein ubiquitination
GO:0021554 optic nerve development
GO:0030182 neuron differentiation
GO:0031290 retinal ganglion cell axon guidance
GO:0035426 extracellular matrix-cell signaling
GO:0035640 exploration behavior
GO:0045446 endothelial cell differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0046697 decidualization
GO:0048678 response to axon injury
GO:0051091 positive regulation of DNA-binding transcription factor activity
GO:0051402 neuron apoptotic process
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0055085 transmembrane transport
GO:0060041 retina development in camera-type eye
GO:0060042 retina morphogenesis in camera-type eye
GO:0060070 canonical Wnt signaling pathway
GO:0060221 retinal rod cell differentiation
GO:0060856 establishment of blood-brain barrier
GO:0060996 dendritic spine development
GO:0061298 retina vasculature development in camera-type eye
GO:0061299 retina vasculature morphogenesis in camera-type eye
GO:0061304 retinal blood vessel morphogenesis
GO:0061518 microglial cell proliferation
GO:0070086 ubiquitin-dependent endocytosis
GO:0071456 cellular response to hypoxia
GO:0097601 retina blood vessel maintenance
GO:0110135 Norrin signaling pathway
GO:1904390 cone retinal bipolar cell differentiation
GO:1990963 establishment of blood-retinal barrier
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0009986 cell surface
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4my2, PDBe:4my2, PDBj:4my2
PDBsum4my2
PubMed24186977
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
Q00604|NDP_HUMAN Norrin (Gene Name=NDP)

[Back to BioLiP]