Structure of PDB 4mwh Chain A

Receptor sequence

>4mwhA (length=371) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MKCRVWSEARVYTNINKQRTEEYWDYENTVIDWSTNTKDYEIENKVGRGK
YSEVFQGVKLDSKVKIVIKMLKPVKKKKIKREIKILTDLSNEKVPPTTLP
FQKDQYYTNQKEDVLKFIRPYIFDQPHNGHANIIHLFDIIKDPISKTPAL
VFEYVDNVDFRILYPKLTDLEIRFYMFELLKALDYCHSMGIMHRDVKPHN
VMIDHKNKKLRLIDWGLAEFYHVNMEYNVRVASRFFKGPELLVDYRMYDY
SLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGTSDFEKYLLKY
EITLPREFYDMDQYIRKPWHRFINDGNKHLSGNDEIIDLIDNLLRYDHQE
RLTAKEAMGHPWFAPIREQIE

3D structure

PDB

4mwh The multiple nucleotide-divalent cation binding modes of Saccharomyces cerevisiae CK2 alpha indicate a possible co-substrate hydrolysis product (ADP/GDP) release pathway.

Chain

Resolution

2.09 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D195 K197 N200 D214 S233
Catalytic site (residue number reindexed from 1)	D195 K197 N200 D214 S233
Enzyme Commision number	2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ATP	A	R48 G49 K50 Y51 S52 V54 V67 K69 V155 D195 H199 N200 M202 I213 D214	R48 G49 K50 Y51 S52 V54 V67 K69 V155 D195 H199 N200 M202 I213 D214
BS02	MG	A	N200 D214	N200 D214
BS03	MG	A	H187 A354	H187 A354
BS04	SO4	A	R268 K317 R321	R268 K317 R321
BS05	SO4	A	R81 R194 N228	R81 R194 N228
BS06	SO4	A	K197 H199	K197 H199
BS07	SO4	A	R316 P318 W319 H320	R316 P318 W319 H320

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0044024	histone H2AS1 kinase activity
GO:0106310	protein serine kinase activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006338	chromatin remodeling
GO:0006356	regulation of transcription by RNA polymerase I
GO:0006359	regulation of transcription by RNA polymerase III
GO:0006468	protein phosphorylation
GO:0006974	DNA damage response
GO:0007535	donor selection
GO:0016310	phosphorylation
GO:0030490	maturation of SSU-rRNA
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0051726	regulation of cell cycle
GO:0060962	regulation of ribosomal protein gene transcription by RNA polymerase II

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005829	cytosol
GO:0005956	protein kinase CK2 complex
GO:0032040	small-subunit processome
GO:0032545	CURI complex
GO:0034456	UTP-C complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4mwh, PDBe:4mwh, PDBj:4mwh
PDBsum	4mwh
PubMed	24531484
UniProt	P15790\|CSK21_YEAST Casein kinase II subunit alpha (Gene Name=CKA1)

[Back to BioLiP]