Structure of PDB 4mvk Chain A

Receptor sequence
>4mvkA (length=171) Species: 9606 (Homo sapiens) [Search protein sequence]
LIPAPPLSKVPLQQNFQDNQFHGKWYVVGVAGNKSLREDKDPWKMYATIY
ELKEDKSYNVTSVGFGTKKCHYKIRTFVPGSQPGEFTLGRIKSRPGRTSA
LVRVVSTNYNQHAMVFFKVVQQNRESFNITLYGRTKELTSELKENFIRFS
KSLGLPENHIVFPVPIDQCID
3D structure
PDB4mvk High-affinity Anticalins with aggregation-blocking activity directed against the Alzheimer beta-amyloid peptide.
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A W49 K50 Y52 T54 S68 G70 H77 K79 R81 F83 F123 V125 N134 T136 Y138 P169 W43 K44 Y46 T48 S62 G64 H71 K73 R75 F77 F117 V119 N128 T130 Y132 P163
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0036094 small molecule binding
GO:0042802 identical protein binding
GO:0140315 iron ion sequestering activity
GO:1903981 enterobactin binding
Biological Process
GO:0006826 iron ion transport
GO:0006915 apoptotic process
GO:0015891 siderophore transport
GO:0042742 defense response to bacterium
GO:0045087 innate immune response
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0031410 cytoplasmic vesicle
GO:0035580 specific granule lumen
GO:0060205 cytoplasmic vesicle lumen
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mvk, PDBe:4mvk, PDBj:4mvk
PDBsum4mvk
PubMed27029347
UniProtP80188|NGAL_HUMAN Neutrophil gelatinase-associated lipocalin (Gene Name=LCN2)

[Back to BioLiP]