Structure of PDB 4mte Chain A

Receptor sequence
>4mteA (length=149) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLRE
AEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFIC
DRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVEAC
3D structure
PDB4mte Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y45 Y64 K78 Y85 Y42 Y61 K75 Y82
BS02 dna A T25 Q27 Q57 P61 R65 T22 Q24 Q54 P58 R62
BS03 ZN A C103 C106 C143 C146 C100 C103 C140 C143
BS04 ZN A H77 C88 H96 E111 H74 C85 H93 E108
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mte, PDBe:4mte, PDBj:4mte
PDBsum4mte
PubMed25369000
UniProtP0AC51|ZUR_ECOLI Zinc uptake regulation protein (Gene Name=zur)

[Back to BioLiP]