Structure of PDB 4mt2 Chain A

Receptor sequence
>4mt2A (length=61) Species: 10117 (Rattus rattus) [Search protein sequence]
MDPNCSCATDGSCSCAGSCKCKQCKCTSCKKSCCSCCPVGCAKCSQGCIC
KEASDKCSCCA
3D structure
PDB4mt2 Comparison of the NMR solution structure and the x-ray crystal structure of rat metallothionein-2.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C15 C19 C24 C29 C15 C19 C24 C29
BS02 ZN A C7 C13 C15 C26 C7 C13 C15 C26
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006882 intracellular zinc ion homeostasis
GO:0010273 detoxification of copper ion
GO:0045926 negative regulation of growth
GO:0071276 cellular response to cadmium ion
GO:0071280 cellular response to copper ion
GO:0071294 cellular response to zinc ion
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mt2, PDBe:4mt2, PDBj:4mt2
PDBsum4mt2
PubMed1438200
UniProtP04355|MT2_RAT Metallothionein-2 (Gene Name=Mt2)

[Back to BioLiP]