Structure of PDB 4mre Chain A |
>4mreA (length=150) Species: 10090 (Mus musculus) [Search protein sequence] |
NQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLA LSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYC FNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDI |
|
PDB | 4mre Fragment-Based Identification of an Inducible Binding Site on Cell Surface Receptor CD44 for the Design of Protein-Carbohydrate Interaction Inhibitors. |
Chain | A |
Resolution | 1.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2C9 |
A |
N29 V30 R155 |
N6 V7 R132 |
MOAD: Kd=6.4mM PDBbind-CN: -logKd/Ki=2.19,Kd=6.4mM BindingDB: Kd=6400000nM |
|
|
|