Structure of PDB 4mrb Chain A

Receptor sequence

>4mrbA (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADTWEPFASGKTSESGELHGLTT
EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL
LSPYSYSTTAVVTNP

3D structure

• PDB: 4mrb Proteolytic cleavage of Ser52Pro variant transthyretin triggers its amyloid fibrillogenesis.
• Chain: A
• Resolution: 1.27 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	E66 D99	E56 D89

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4mrb, PDBe:4mrb, PDBj:4mrb
• PDBsum: 4mrb
• PubMed: 24474780
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)