Structure of PDB 4mml Chain A |
>4mmlA (length=67) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFAQFVILLKNTVSQM VYKHAISTVVPSRPVRL |
|
PDB | 4mml Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability. |
Chain | A |
Resolution | 1.801 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
U |
A |
Q8 Q41 F42 |
Q5 Q38 F39 |
|
|
|
|