Structure of PDB 4mmk Chain A |
>4mmkA (length=69) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
SKGHSLADPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVS QMVYKHAISTVVPSRPVRL |
|
PDB | 4mmk Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability. |
Chain | A |
Resolution | 2.156 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H5 D9 |
H4 D8 |
|
|
|
|