Structure of PDB 4mm1 Chain A

Receptor sequence

>4mm1A (length=238) Species: 187420 (Methanothermobacter thermautotrophicus str. Delta H)

FKMKVEDYFHDILRERKIHLTLIDPEEQTPEEAVEIARAAIRGGTDGIML
GGSTTDSSELDNTARALRENIDVPIILFPGNTTGVSRYADAIFFMSLLNS
TNPYWIIGAQALGAATVKKMGIEALPMGYLVVEPGGTVGWVGDTKPVPRN
KPDIAAAYAMAAEFLGMRLFYLEAGSGAPEHVPEEMIALVKRCTDQILIV
GGGIRSGEDAARVAGAGADVVVTGTVEDKIREIVEGMG

3D structure

• PDB: 4mm1 A comprehensive analysis of the geranylgeranylglyceryl phosphate synthase enzyme family identifies novel members and reveals mechanisms of substrate specificity and quaternary structure organization.
• Chain: A
• Resolution: 2.8004 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.41: phosphoglycerol geranylgeranyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1GP	A	L23 Y172 E174 S177 G202 G203 G225 T226	L22 Y171 E173 S176 G201 G202 G224 T225

Gene Ontology

Molecular Function

• GO:0000107 imidazoleglycerol-phosphate synthase activity
• GO:0000287 magnesium ion binding
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding
• GO:0047294 phosphoglycerol geranylgeranyltransferase activity

Biological Process

• GO:0006650 glycerophospholipid metabolic process
• GO:0008654 phospholipid biosynthetic process
• GO:0046474 glycerophospholipid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4mm1, PDBe:4mm1, PDBj:4mm1
• PDBsum: 4mm1
• PubMed: 24684232
• UniProt: O26652|GGGPS_METTH Geranylgeranylglyceryl phosphate synthase (Gene Name=MTH_552)