Structure of PDB 4mls Chain A

Receptor sequence
>4mlsA (length=81) Species: 1314 (Streptococcus pyogenes) [Search protein sequence]
SATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGK
YTFVETAAPDGYEVATAITFTVNEQGQVTVN
3D structure
PDB4mls Structural Analysis and Optimization of the Covalent Association between SpyCatcher and a Peptide Tag.
ChainA
Resolution1.984 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A I27 K28 F29 S30 K31 R32 E34 D35 L39 M44 F75 E77 G83 Y84 E85 A87 I90 V100 I5 K6 F7 S8 K9 R10 E12 D13 L17 M22 F53 E55 G61 Y62 E63 A65 I68 V78
External links