Structure of PDB 4mhv Chain A |
>4mhvA (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] |
AVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVN VNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN |
|
PDB | 4mhv Crystal structure of the PNT domain of human ETS2 |
Chain | A |
Resolution | 2.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
I167 N170 |
I91 N94 |
|
|
|
|