Structure of PDB 4mht Chain A

Receptor sequence

>4mhtA (length=327) Species: 726 (Haemophilus haemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 4mht Enzymatic C5-cytosine methylation of DNA: mechanistic implications of new crystal structures for HhaL methyltransferase-DNA-AdoHcy complexes.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C81 E119 R163 R165
• Catalytic site (residue number reindexed from 1): C81 E119 R163 R165
• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y44 I86 Q90 G236 Q237 E239 G256 G257 Q297	Y44 I86 Q90 G236 Q237 E239 G256 G257 Q297
BS02	dna	A	G78 F79 C81 S85 I86 S87 K89 R97 E119 K162 R165 T226 R228 Q237 R240 Y242 T250 A253 Y254 G255 G256 G303 N304	G78 F79 C81 S85 I86 S87 K89 R97 E119 K162 R165 T226 R228 Q237 R240 Y242 T250 A253 Y254 G255 G256 G303 N304
BS03	SAH	A	F18 A19 G20 L21 G23 E40 W41 G78 N304 S305	F18 A19 G20 L21 G23 E40 W41 G78 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:4mht, PDBe:4mht, PDBj:4mht
• PDBsum: 4mht
• PubMed: 8800212
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)