Structure of PDB 4mhg Chain A

Receptor sequence
>4mhgA (length=90) Species: 10090 (Mus musculus) [Search protein sequence]
RLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTN
MTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS
3D structure
PDB4mhg Steric Mechanism of Auto-Inhibitory Regulation of Specific and Non-Specific DNA Binding by the ETS Transcriptional Repressor ETV6.
ChainA
Resolution2.199 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y387 E388 R392 R395 Y398 K405 R410 L411 Y53 E54 R58 R61 Y64 K71 R76 L77 PDBbind-CN: Kd=10uM
BS02 dna A L336 W376 K380 R382 M385 K389 R392 H396 Y397 L2 W42 K46 R48 M51 K55 R58 H62 Y63 PDBbind-CN: Kd=10uM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4mhg, PDBe:4mhg, PDBj:4mhg
PDBsum4mhg
PubMed24333486
UniProtP97360|ETV6_MOUSE Transcription factor ETV6 (Gene Name=Etv6)

[Back to BioLiP]