Structure of PDB 4m7t Chain A

Receptor sequence

>4m7tA (length=246) Species: 1397 (Niallia circulans)

MDKLFSMIEVEVNSQCNRTCWYCPNSVSKRKETGEMDPALYKTLMEQLSS
LDFAGRISFHFYGEPLLCKNLDLFVGMTTEYIPRARPIIYTNGDFLTEKR
LQTLTELGIQKFIVTQHAGAKHKFRGVYDQLAGADKEKVVYLDHSDLVLS
NRGGILDNIPANMSCMVPSNLAVVTVLGNVLPCFEDFNQKMVMGNIGEQH
ISDIWHNDKFTSFRKMLKEGHRGKSDLCKNCNNVSVQTEEQYDYVL

3D structure

• PDB: 4m7t X-ray analysis of butirosin biosynthetic enzyme BtrN redefines structural motifs for AdoMet radical chemistry.
• Chain: A
• Resolution: 1.56 Å

Enzymatic activity

• Enzyme Commision number: 1.1.99.38: 2-deoxy-scyllo-inosamine dehydrogenase (AdoMet-dependent).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C16 R18 C20 C23 N25 Y62 N92 H117	C16 R18 C20 C23 N25 Y62 N92 H117
BS02	SF4	A	C169 C187 E189 L221 R226 L231 C232 C235	C165 C183 E185 L217 R222 L227 C228 C231
BS03	SAM	A	Y22 H60 G63 Y90 T91 N92 T115 H117 L149 S150 R152	Y22 H60 G63 Y90 T91 N92 T115 H117 L149 S150 R152
BS04	25W	A	E9 Y90 R152 F188 Y246 V249	E9 Y90 R152 F184 Y242 V245

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0017000 antibiotic biosynthetic process

External links

• PDB: RCSB:4m7t, PDBe:4m7t, PDBj:4m7t
• PDBsum: 4m7t
• PubMed: 24048029
• UniProt: Q8G907|BTRN_NIACI S-adenosyl-L-methionine-dependent 2-deoxy-scyllo-inosamine dehydrogenase (Gene Name=btrN)