Structure of PDB 4m6y Chain A

Receptor sequence

>4m6yA (length=335) Species: 1912 (Streptomyces hygroscopicus)

TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAV
RHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQ
GSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAV
DGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEV
AAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHLFWPRENCV
QTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYL
PTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE

3D structure

• PDB: 4m6y Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.281: phenylpyruvate C(3)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	A	S140 G166 R172 D189 I190 G216 D217 A218 M240 M241 L244	S138 G164 R170 D187 I188 G214 D215 A216 M238 M239 L242
BS02	56D	A	W99 R127 M240 H243 A273 F287 F291 H295	W97 R125 M238 H241 A271 F285 F289 H293
BS03	FE	A	H243 H295	H241 H293
BS04	HF2	A	D309 F312 C319 V320 K321 K322	D307 F310 C317 V318 K319 K320
BS05	CA	A	D306 D309	D304 D307
BS06	CA	A	S225 G228 F230	S223 G226 F228

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity

Biological Process

• GO:0009058 biosynthetic process
• GO:0017000 antibiotic biosynthetic process
• GO:0032259 methylation

External links

• PDB: RCSB:4m6y, PDBe:4m6y, PDBj:4m6y
• PDBsum: 4m6y
• PubMed: 24914966
• UniProt: Q643C8|MPPJ_STRHY Phenylpyruvate C(3)-methyltransferase (Gene Name=mppJ)