Structure of PDB 4m6f Chain A

Receptor sequence

>4m6fA (length=188) Species: 10677 (Muvirus mu)

LIGYVRVSTNDQNTDLQRNALVCAGCEQIFEDKLSGTRTDRPGLKRALKR
LQKGDTLVVWKLDRLGRSMKHLISLVGELRERGINFRSLTDSIDTSSPMG
RFFFHVMGALAEVERELIIERTMAGLAAARNKGRIGGRPPKLTKAEQEQA
GRLLAQGIPRKQVALIYDVALSTLYKKHPAKRAHIEND

3D structure

• PDB: 4m6f Exploiting large non-isomorphous differences for phase determination of a G-segment invertase-DNA complex.
• Chain: A
• Resolution: 4.99 Å

Enzymatic activity

• Enzyme Commision number: 3.1.22.-
  6.5.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	M70 K71 L127 G137 G138 R139 P141 V170 A171 L172 S173 T174 R183 A184 H185 I186 E187 N188 D189	M69 K70 L126 G136 G137 R138 P140 V169 A170 L171 S172 T173 R182 A183 H184 I185 E186 N187 D188
BS02	dna	A	R122 T123 G126 L127 A130 R135 G137 G138 R139 P140 S173 Y176 A181 K182 I186 E187 N188 D189	R121 T122 G125 L126 A129 R134 G136 G137 R138 P139 S172 Y175 A180 K181 I185 E186 N187 D188

Gene Ontology

Molecular Function

• GO:0000150 DNA strand exchange activity
• GO:0003677 DNA binding
• GO:0016787 hydrolase activity
• GO:0016874 ligase activity

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration
• GO:0046718 symbiont entry into host cell
• GO:0098678 viral tropism switching

Cellular Component

• GO:0030430 host cell cytoplasm

External links

• PDB: RCSB:4m6f, PDBe:4m6f, PDBj:4m6f
• PDBsum: 4m6f
• PubMed: 24598738
• UniProt: P03015|GIN_BPMU Serine recombinase gin (Gene Name=gin)