Structure of PDB 4m5o Chain A

Receptor sequence

>4m5oA (length=200) Species: 985958 (Influenza A virus (A/Lima/WRAIR1695P/2009(H1N1)))

GPLGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVC
FMYSDFHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSIC
NTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHI
HIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSE

3D structure

• PDB: 4m5o Crystallographic fragment screening and structure-based optimization yields a new class of influenza endonuclease inhibitors.
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H46 D113 E124 I125
BS02	MN	A	E80 D108	E85 D113
BS03	X48	A	K34 I38 H41 E80 D108 E119 K134	K39 I43 H46 E85 D113 E124 K139	MOAD: ic50=0.38uM PDBbind-CN: -logKd/Ki=6.42,IC50=0.38uM
BS04	X48	A	K19 E23 Y24 G81 R82 D83	K24 E28 Y29 G86 R87 D88	MOAD: ic50=0.38uM PDBbind-CN: -logKd/Ki=6.42,IC50=0.38uM
BS05	X48	A	Y24 E26 E80	Y29 E31 E85	MOAD: ic50=0.38uM PDBbind-CN: -logKd/Ki=6.42,IC50=0.38uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 00:53:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4m5o', asym_id = 'A', title = 'Crystallographic fragment screening and structur...a new class of influenza endonuclease inhibitors.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4m5o', asym_id='A', title='Crystallographic fragment screening and structur...a new class of influenza endonuclease inhibitors.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0039694', uniprot = '', pdbid = '4m5o', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0039694', uniprot='', pdbid='4m5o', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>