Structure of PDB 4m4k Chain A

Receptor sequence

>4m4kA (length=238) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

VHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNR
ASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKL
HPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLENDEFFVRIRDAGL
QVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDN
VKYKILKVHEMLIDQVPVTILNILLDCDVNKTPWCDCS

3D structure

PDB

4m4k Crystal Structures of beta-1,4-Galactosyltransferase 7 Enzyme Reveal Conformational Changes and Substrate Binding.

Chain

Resolution

2.2 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D145 D147 W207 E210 N211 T238 H241 H243
Catalytic site (residue number reindexed from 1)	D72 D74 W134 E137 N138 T165 H168 H170
Enzyme Commision number	2.4.1.133: xylosylprotein 4-beta-galactosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	XYP	A	Y177 Y179 F182 G208 L209 N211 D212	Y104 Y106 F109 G135 L136 N138 D139
BS02	MN	A	D147 H241 H243	D74 H168 H170
BS03	GDU	A	P82 F83 R84 R86 F121 R123 D145 V146 D147 Y177 G185 W207 G208 E210 N211 H241 H243 R250	P9 F10 R11 R13 F48 R50 D72 V73 D74 Y104 G112 W134 G135 E137 N138 H168 H170 R177

Gene Ontology

	Molecular Function
GO:0016757	glycosyltransferase activity

	Biological Process
GO:0005975	carbohydrate metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4m4k, PDBe:4m4k, PDBj:4m4k
PDBsum	4m4k
PubMed	24052259
UniProt	Q9VBZ9\|B4GT7_DROME Beta-1,4-galactosyltransferase 7 (Gene Name=beta4GalT7)

[Back to BioLiP]