Structure of PDB 4lxx Chain A

Receptor sequence

>4lxxA (length=273) Species: 407148 (Campylobacter jejuni subsp. jejuni 81116)

GHMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSL
LKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFS
ALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDIND
TARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLV
HKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFE
EFENYFIISGIDGFKIIAQKLNK

3D structure

• PDB: 4lxx Structure of a sugar N-formyltransferase from Campylobacter jejuni.
• Chain: A
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FON	A	F78 Q80 I81 I82 N94 I127 D128 G130 D132 S191 R192	F80 Q82 I83 I84 N96 I129 D130 G132 D134 S193 R194
BS02	FNF	A	K9 E77 F78 H96 G105 F107 T108 S109 D132 Y154 R192 L197 F219 Y222 Q223	K11 E79 F80 H98 G107 F109 T110 S111 D134 Y156 R194 L199 F221 Y224 Q225

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 20:29:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4lxx', asym_id = 'A', title = 'Structure of a sugar N-formyltransferase from Campylobacter jejuni.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4lxx', asym_id='A', title='Structure of a sugar N-formyltransferase from Campylobacter jejuni.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009058', uniprot = '', pdbid = '4lxx', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009058', uniprot='', pdbid='4lxx', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>