Structure of PDB 4lwt Chain A

Receptor sequence

>4lwtA (length=86) Species: 8355 (Xenopus laevis)

MEKLVQPTPLLLSLLKSAGAQKETFTMKEVLYHLGQYIMAKQLYDEKQQH
IVHCSNDPLGELFGVQEFSVKEHRRIYAMISRNLVS

3D structure

• PDB: 4lwt Discovery of potent and selective spiroindolinone MDM2 inhibitor, RO8994, for cancer therapy.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	20Q	A	L50 I57 Y63 V89 H92	L31 I38 Y44 V70 H73	MOAD: ic50=3.9uM PDBbind-CN: -logKd/Ki=5.41,IC50=3.9uM

Gene Ontology

Biological Process

• GO:0043066 negative regulation of apoptotic process
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4lwt, PDBe:4lwt, PDBj:4lwt
• PDBsum: 4lwt
• PubMed: 24997575
• UniProt: P56273|MDM2_XENLA E3 ubiquitin-protein ligase Mdm2 (Gene Name=mdm2)