Structure of PDB 4lw1 Chain A

Receptor sequence

>4lw1A (length=123) Species: 9606 (Homo sapiens)

GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMS
DGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILM
ELEVLKSAEAVGVKIGNPVPYNE

3D structure

• PDB: 4lw1 Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
• Chain: A
• Resolution: 1.631 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1XS	A	R41 M57 A59 T60 I95	R44 M60 A62 T63 I98	MOAD: Kd=710uM PDBbind-CN: -logKd/Ki=3.15,Kd=710uM BindingDB: Kd=710000nM
BS02	1XS	A	R31 I33 R43 S55 L87 R91 V93	R34 I36 R46 S58 L90 R94 V96	MOAD: Kd=710uM PDBbind-CN: -logKd/Ki=3.15,Kd=710uM BindingDB: Kd=710000nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006260 DNA replication

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4lw1, PDBe:4lw1, PDBj:4lw1
• PDBsum: 4lw1
• PubMed: 24147804
• UniProt: P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)