Structure of PDB 4lvk Chain A

Receptor sequence

>4lvkA (length=191) Species: 1311 (Streptococcus agalactiae) [Search protein sequence]

SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSY
EKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFE
TAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDRE
ELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM

3D structure

PDB

4lvk Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.

Chain

Resolution

2.37 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	R71 A72 R74 K75 D76	R66 A67 R69 K70 D71
BS02	dna	A	Y3 V5 R7 M8 K10 K12 R74 D76 V78 H126 E129 S130 T131 H135 K145 K149 D153 R154 L157 K158 Q161 R177 G178 K179 N181 S182 A184 H186 K187 V189 F192 K193 M196	Y2 V4 R6 M7 K9 K11 R69 D71 V73 H121 E124 S125 T126 H130 K140 K144 D148 R149 L152 K153 Q156 R172 G173 K174 N176 S177 A179 H181 K182 V184 F187 K188 M191
BS03	MN	A	H126 E129 H133 H135	H121 E124 H128 H130

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4lvk, PDBe:4lvk, PDBj:4lvk
PDBsum	4lvk
PubMed	28739894
UniProt	P13925\|PRE_STRAG Plasmid recombination enzyme (Gene Name=pre)

[Back to BioLiP]