Structure of PDB 4lvj Chain A

Receptor sequence

>4lvjA (length=192) Species: 1311 (Streptococcus agalactiae) [Search protein sequence]

SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVS
YEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFF
ETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDR
EELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM

3D structure

PDB

4lvj Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.

Chain

Resolution

2.17 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	R71 A72 R74 K75 D76 K149	R67 A68 R70 K71 D72 K145
BS02	dna	A	Y3 V5 R7 M8 K10 K12 H22 R74 D76 V78 W83 I84 T86 E129 S130 T131 H133 H135 K149 D153 R154 L157 K158 Q161 R177 G178 K179 N181 S182 A184 H186 K187 V189 F192 K193 M196	Y2 V4 R6 M7 K9 K11 H21 R70 D72 V74 W79 I80 T82 E125 S126 T127 H129 H131 K145 D149 R150 L153 K154 Q157 R173 G174 K175 N177 S178 A180 H182 K183 V185 F188 K189 M192
BS03	MN	A	H22 H126 E129 H133 H135	H21 H122 E125 H129 H131

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4lvj, PDBe:4lvj, PDBj:4lvj
PDBsum	4lvj
PubMed	28739894
UniProt	P13925\|PRE_STRAG Plasmid recombination enzyme (Gene Name=pre)

[Back to BioLiP]