Structure of PDB 4luv Chain A

Receptor sequence

>4luvA (length=123) Species: 9606 (Homo sapiens)

GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMS
DGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILM
ELEVLKSAEAVGVKIGNPVPYNE

3D structure

• PDB: 4luv Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
• Chain: A
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1XS	A	R41 M57 A59 T60 N85 I95	R44 M60 A62 T63 N88 I98	MOAD: Kd=1400uM PDBbind-CN: -logKd/Ki=2.85,Kd=1400uM BindingDB: Kd=710000nM
BS02	1DZ	A	R31 I33 R43 S55 M57 V93	R34 I36 R46 S58 M60 V96	MOAD: Kd=580uM BindingDB: Kd=580000nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006260 DNA replication

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4luv, PDBe:4luv, PDBj:4luv
• PDBsum: 4luv
• PubMed: 24147804
• UniProt: P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)