Structure of PDB 4lq0 Chain A

Receptor sequence

>4lq0A (length=298) Species: 330483 (Leptographium truncatum) [Search protein sequence]

NIEYLNWYICGLVDAEGSFGVNVVKHATNKTGYAVLTYFELAMNSKDKQL
LELIKKTFDLECNIYHNPSDDTLKFKVSNIEQIVNKIIPFFEKYTLFSQK
RGDFILFCKVVELIKNKEHLTLNGLMKILSIKAAMNLGLSENLKKEFPGC
LSVKRPEFGLSNLNKRWLAGFIEGEACFFVSIYNSPKSKLGKAVQLVFKI
TQHIRDKILIESIVELLNCGRVEVRKSNEACDFTVTSIKEIENYIIPFFN
EYPLIGQKLKNYEDFKLIFDMMKTKDHLTEEGLSKIIEIKNKMNTNRI

3D structure

PDB

4lq0 Structural Comparisons of LAGLIDADG Homing Endonucleases.

Chain

Resolution

2.68 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	H32 T34 N35 K36 N69 Y71 N73 P74 S75 K82 S84 N85 I86 H125 G180 E181 A182 C183 F185 K205 T207 Q208 H209 R231 N300 T301	H26 T28 N29 K30 N63 Y65 N67 P68 S69 K76 S78 N79 I80 H119 G174 E175 A176 C177 F179 K199 T201 Q202 H203 R225 N294 T295
BS02	dna	A	A21 E22 S24 E46 A48 M49 N50 D76 K80 K106 N142 L143 S146 Y189 K193 S194 K195 Q201 R227 E229 T242 S243 I244 H283	A15 E16 S18 E40 A42 M43 N44 D70 K74 K100 N136 L137 S140 Y183 K187 S188 K189 Q195 R221 E223 T236 S237 I238 H277
BS03	CA	A	E22 G180	E16 G174
BS04	CA	A	A21 E181	A15 E175
BS05	CA	A	E22 E181	E16 E175

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005739	mitochondrion

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4lq0, PDBe:4lq0, PDBj:4lq0
PDBsum	4lq0
PubMed
UniProt	E0YCK3

[Back to BioLiP]