Structure of PDB 4lnl Chain A

Receptor sequence

>4lnlA (length=332) Species: 945433 (Escherichia coli WV_060327)

MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKE
AAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQP
QPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLK
EAWEFTRKRNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLG
TPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQ
EDHDNTAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSRAQLAEVAAHWRAFLA

3D structure

• PDB: 4lnl On the catalytic mechanism and stereospecificity of Escherichia coli l-threonine aldolase.
• Chain: A
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	T8 T10 S196 T201	T8 T10 S196 T201
BS02	2BO	A	S6 G58 T59 H83 E136 D166 A168 R169 K197 R308	S6 G58 T59 H83 E136 D166 A168 R169 K197 R308
BS03	2BK	A	S6 G58 T59 H83 E136 D166 A168 R169 K197 R308	S6 G58 T59 H83 E136 D166 A168 R169 K197 R308
BS04	MG	A	V94 S97	V94 S97

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 16:03:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4lnl', asym_id = 'A', title = 'On the catalytic mechanism and stereospecificity of Escherichia coli l-threonine aldolase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4lnl', asym_id='A', title='On the catalytic mechanism and stereospecificity of Escherichia coli l-threonine aldolase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006520,0016829', uniprot = '', pdbid = '4lnl', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006520,0016829', uniprot='', pdbid='4lnl', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>